Manufacturers Directory from Taiwan, China, Asia Manufacturers and Suppliers and exporters

Join Us | Sign In | User Guide | Inquiry Cart
Bridging the Gap Between Buyers and Suppliers
Forward This Page
Recipient Name :
* Recipient E-mail :
* Your Name :
* Your E-Mail :
* Messages :
* Security Code :
 (AsianProducts will not reuse you or your friend's email address for any purpose.)

Preview page to be forwarded to your friend

gem raw materials Manufacturer - gem raw materials Manufacturers and gem raw materials Supplier

gem raw materials Manufacturer - gem raw materials Manufacturers and gem raw materials Supplier

Home > Search : gem raw materials
gem raw materials (24248 products Found)
Item Per Page : Next »
GE Series General AGM Battery (6V), UPS Battery, 1Ah-200Ah (prostar)

Category: Rechargeable Sealed Lead Acid Batteries

‧Absorbent Glass Mat (AGM) technology ensures efficient gas recombination up to 99% and freedom from electrolyte maintenance. During the expected float service life of Prostar batteries, no need to ...
Keyword : GEM battery

Inquire Now
Copper (II) Oxide (1317-38-0)

Category: Acetic Acid, Glacial Acetic Acid

Copper oxide is a black single crystal is the crystallization or black to palm black amorphous crystal powder material used as glass, porcelain, the pigment, desulfurizer, catalyst, and for the rayon ...

Inquire Now
2012 new Organic Germanium Health Soap manufacturers (CMZ--042)

Category: Soap Dishes / Plates

Germanium ions soap The main components Germanium , tourmaline, negative ions, essential oil, vegetable oil, natural milk, 破plant acid. How to use: you can rub germanium soap onto the skin,til ...

Inquire Now
Diamond Powder (1111)

Category: Hardware, General

Features: The raw materials are high-quality diamond with high strength and high purity. Regular crystalline form, concentrated particle distribution, few impurities, good heat stability and high w ...

Inquire Now
Copy - Magic side tapes or PP side tapes for diapers--raw materials (VT-01)

Category: Plastic Raw Materials (Powder & Compound)

Description As a major component of diapers for infants and adults,the Diaper Side Tape is a result of careful backing finishing, computer-controlled coating technology and precise manufacturing.It po ...
Keyword : raw materials

Inquire Now
Magic side tapes or PP side tapes for diapers--raw materials (VT-01)

Category: Plastic Raw Materials (Powder & Compound)

Description As a major component of diapers for infants and adults,the Diaper Side Tape is a result of careful backing finishing, computer-controlled coating technology and precise manufacturing.It ...
Keyword : raw materials

Inquire Now
Sale Testosterone Enanthate raw materials powder (315-37-7 )

Category: Pharmaceutical raw materials

Product name:Testosterone Enanthate ,test e raw materials powder Other name:Testosterone Enanthate,Andryl, Arderone, Testosterone enanthate, Delatest, Delatestryl, Depo-Testro-Med,test e Molecular ...
Keyword : test e | test e raw materials powder

Inquire Now
Certification : ,,,,,,,,,,,,SGS,
Angiotensin acetate CAS 58-49-1 Peptide Human Growth Hormone Pharmaceutical raw materials (skype:Candice148722)

Category: Pharmaceutical raw materials

Angiotensin acetate CAS 58-49-1 Peptide Human Growth Hormone Pharmaceutical raw materials to vasoconstriction skype:Candice148722 Quick Detail: 1.Product Name: Angiotensin acetate 2.CAS 58-49-1 3.U ...

Inquire Now
tpe plastic raw materials for extrusion use (45a-50d)

Category: Plastic Raw Materials (Powder & Compound)

Pacrel TPE/elastomer -green material -compound by PP and EPDM -excellent weather uv and ozone resistance -can be colored, recycled
Keyword : plastic raw material | tpe material

Inquire Now
Certification : ,,,,,,,,,,,,SGS,ISO9001/14001
PP EPDM/SEBS TPV thermoplastic raw materials in pellets (45a-50d)

Category: Plastic Raw Materials (Powder & Compound)

Pacrel TPE/TPV -green material -compound by PP and EPDM -excellent weather uv and ozone resistance -can be colored, recycled
Keyword : thermoplastic raw material

Inquire Now
Certification : ,,,,,,,,,,,,SGS,ISO9001/14001
PP EPDM based TPV raw materials for injection, extrusion, blow molding (45A-50D)

Category: Plastic Raw Materials (Powder & Compound)

Pacrel TPE/TPV(PP/EPDM) -green material -compound by PP and EPDM -excellent weather uv and ozone resistance -can be colored, recycled
Keyword : tpv raw material | tpv material | tpe material

Inquire Now
Certification : ,,,,,,,,,,,,SGS,ISO9001/14001
Competitive Prices! TPV/TPE plastic raw materials for selling (45A-50D)

Category: Plastic Raw Materials (Powder & Compound)

TPV/TPE's Main Properties: -Excellent weather resistance (UV and ozone) -Excellent adhesion to polyolefins -Excellent flex-resistance -Good adhesion to paints -Soft touch and high quality surface ...
Keyword : tpv material | tpe material | plastic raw material

Inquire Now
Certification : ISO9001/ISO14001
Thermoplastic elastomer TPV plastic raw materials for automotive components (45A-50D)

Category: Plastic Raw Materials (Powder & Compound)

TPV Main Properties: -Excellent weather resistance (UV and ozone) -Excellent adhesion to polyolefins -Excellent flex-resistance -Good adhesion to paints -Soft touch and high quality surface -Can ...
Keyword : tpv material | tpe material | tpv raw material

Inquire Now
Certification : ISO9001/ISO14001
Plastic Raw Materials-HDPE-High Density Polyethylene (9002-88-4)

Category: Plastic Raw Materials (Powder & Compound)

HDPE Plastic raw materials/HDPE Granules/HDPE Resin/High Density Polyethylene HDPE Wihte Granules virign adn recycled HDPE HDPE Grade:film/pipe/injection/blowing grade HDPE property: have goo ...
Keyword : Plastic Raw Materials

Inquire Now
raw materials (RYS-02)

Category: Medicines & Raw Materials

We can supply some kinds of raw materials, such as Mezlocillin Sodium, Cefotaxime Sodium, Ceftriaxone Sodium, Piperacillin Sodium etc. Please feel free to contact us for more information.
Keyword : raw materials

Inquire Now
pharmaceutical raw materials Letrazole(Femara) ( 112809-51-5)

Category: Pharmaceutical raw materials

Letrazole(Femara) My email is ycwlb032 at yccreate dot com skype:emilylee1990 Our company can supply many high-quality products.Welcome to inquiry and I will give you more detailed information about o ...

Inquire Now
Sermorelin raw materials wholesale (86168-78-7 )

Category: Pharmaceutical raw materials

Sermorelin raw materials wholesale Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Usage: xanthine oxidase inhibitor Deta ...

Inquire Now
Pharmaceutical Raw Materials (999)

Category: Pharmaceutical raw materials

Sonus International – We are Leading Manufacture of Pharmaceutical raw materials, Pharmaceutical Formulations, Chemicals and Packaging and Labelling materials in Worldwide. Visit Know More Informati ...
Keyword : Packaging and Labelling Materials

Inquire Now
Turinabol powder Standard Substance, anabolic steroids raw powder, skype: bjxrkysw (B-1)

Category: Plastic Raw Materials (Powder & Compound)

Turinabol powder Standard Substance, anabolic steroids raw powder Product name: Turinabol powder Standard Substance, anabolic steroids raw powder We could give you: 1. Best quality in your requireme ...
Keyword : raw powder

Inquire Now
Testosterone Acetate powder Standard Substance, anabolic steroids raw powder (B-3)

Category: Plastic Raw Materials (Powder & Compound)

Testosterone Acetate powder Standard Substance, anabolic steroids raw powder We could give you: 1. Best quality in your requirement 2. Competitive price in China market 3. Mature Technical support 4. ...
Keyword : raw powder

Inquire Now

Total 1213 Page(s) 12345678910Next >
Dissatisfied? Contact us your search require!

Product Alert

Enter your Interested Keyword:

Your E-mail:

(We will not sell or share your e-mail address.)