urate oxidase Manufacturer - urate oxidase Manufacturers and urate oxidase Supplier

Join Us | Sign In | User Guide | Inquiry Cart
Home > Search : urate oxidase
urate oxidase (24 products Found)

Refine urate oxidase By

Item Per Page : Next »
glucose oxidase from aspergillus niger (9001-37-0 )

Category: Slimming Aids

glucose oxidase from aspergillus niger product Name: glucose oxidase from aspergillus niger CAS Registry Number: 9001-37-0 EINECS: 232-601-0 Packing:25kg/bag Assay:900U/G

Inquire Now
glucose oxidase from aspergillus niger (9001-37-0 )

Category: Feedstuff Additives

More information,lps contact: Skype:Samantha7917 Phone:86-027-50756063 E-mail:samantha@ycphar.com product Name: glucose oxidase from aspergillus niger CAS Registry Number: 9001-37-0 EINECS: 232-601 ...
Keyword : glucose oxidase from aspergillus niger

Inquire Now
Chicken Super Oxidase Dimutase(SOD) elisa kit (CK-E90342)

Category: Health Products and Equipment

Elisa kit 1.Brand: Eastbiopharm 2.High sensitivity 3.Low price 4.Stable performance Human Lipoarabinomannan,LAM elisa kit Please carefully read this instruction before using. This ELISA ...

Inquire Now
Rat monoamine oxidase(MAO)ELISA Kit (QY-E10001)

Category: Make-Up Kits

double-antibody sandwich enzyme-linked immunosorbent assay

Inquire Now
Copy - organic wheat grass powder (200 mesh)

Category: Other Vegetable Materials

Wheatgrass benefits are so easy to achieve and feel because: ‧30mls of freshly squeezed wheatgrass juice (a wheatgrass shot!) is equivalent in nutritional value to 1kg of leafy green vegetables ...

Inquire Now
organic wheat grass powder (200 mesh)

Category: Other Vegetable Materials

Wheatgrass benefits are so easy to achieve and feel because: ‧30mls of freshly squeezed wheatgrass juice (a wheatgrass shot!) is equivalent in nutritional value to 1kg of leafy green vegetables ...

Inquire Now
Sermorelin raw materials wholesale (86168-78-7 )

Category: Pharmaceutical raw materials

Sermorelin raw materials wholesale Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Usage: xanthine oxidase inhibitor Deta ...

Inquire Now
Sermorelin, 2mg/vial (2mg/vial)

Category: Pharmaceutical raw materials


Inquire Now
Black Bean Hull Extract(Black Bean Red) (3)

Category: Plant Extracts

Appearance: purple red powder Active ingredient: anthocyanin Specifications:5%,10%,15%,20%,25% Botanical Source:Black Soybean Latin name:Glycinemax(L.)merr Part used: black bean hull Grade: food grad ...

Inquire Now
Iterative Crystallography Service:Diamine Acetyltransferase 1 (CBCRY21)

Category: services

Spermidine/spermine N(1)-acetyltransferase (SSAT; EC is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the N(1)-acetylation of spermidine and spermine ...

Inquire Now
United States(US)
VELAS30W Chiropractic Pain therapy laser (VELAS30W)

Category: Surgical lasers

VELAS30W Chiropractic Pain therapy laser Specifications High power laser therapy 30Watt The central goal of laser therapy is to stimulate the cell to perform its natural functions The VELAS 30 Foc ...

Inquire Now
Scalliops (product size)

Category: Snacks and Candy

Clam: the annual export volume of 2000 tons, Jiaozhou Bay and Red Island clam farming as raw materials, shellfish farmers, farming environment, monitoring the entire process, from the waters, beaches ...

Inquire Now
Japanese black garlic capsule (432432)

Category: Health Enhancing Products

Black garlic capsule is made of black garlic that has been aged and fermented, offering nearly twice the amount of antioxidants which are essential in the body for proper function of the immune system ...

Inquire Now
Bakerdream F-99 bread improver for frozen dough (83000316)

Category: Yeasts, Baking Powder

Specifications bread improver 1.enhance the fermenting stability 2.maintain good expansion in oven 3.protects the activity of yeast Detailed Product Description This product can be us ...

Inquire Now
sericin powder (xts03)

Category: Cosmetics

Sericin is a kind of protein surrounding fibroin (silk protein), yellowy powder and soluble in water with pH value between 5 to 7 and positive ninhydrin reaction. ·Application characteristics: In ...

Inquire Now
Certification : FDA,FDA
Clinical Chemsitry Reagents (PZ-02)

Category: Diagnostic Reagents

ApoA1 Immunoturbidimetric ApoB Immunoturbidimetric LP (a) ITA HDL-C Enzyme Clearance LDL-C Enzyme Clearance CK NAC-act Mg MTB TBA Enzymatic Cycling PA ITA LDH L-P UREA/BUN Borthelot ALP / A ...

Inquire Now
Certification : CE,CE
St.John’s Wort Extract (Hypericin:0.3%)

Category: Plant Extracts

Product Name: St.John’s Wort P.E Botanical Source: Hypericum perforatum L. Appearance: Dark brown to brownish-black fine powder Standard: Hypericin:0.3% Water: not more than 5.0% Package: 25/KG ...

Inquire Now
St. John’s Wort Extract 0.3% Hypericin(sally@nutra-max.com) (Hypericin)

Category: Plant Extracts

Specification: total Hypericin 0.3%(UV), 0.5% 1% 10% 98%(HPLC) Color: Light-yellow or yellow-brown powdered extract CAS#.: 548-04-9 Solubility: good soluble in ethanol, methanol, pyridine, aceton, eth ...
Keyword : St John s Wort Extract | St John s Wort PE | St John s Wort Powder Extract

Inquire Now
Certification : FDA,Kosher&HALAL,GMP
Ethyl cinnamate (007)

Category: Chemicals

Ethyl cinnamate is the ester of cinnamic acid and ethanol. It is present in the essential oil of cinnamon. Pure ethyl cinnamate has a "fruity and balsamic odor, reminiscent of cinnamon with an amber n ...

Inquire Now
white pekoe (white pekoe)

Category: Tea and Substitutes

White teas are made from buds and young leaves picked shortly before the buds have fully opened, which are steamed or fired to inactivate polyphenol oxidase, and then dried.

Inquire Now

Total 2 Page(s) 12Next >
Dissatisfied? Contact us your search require!

Product Alert

Enter your Interested Keyword:

Your E-mail:

(We will not sell or share your e-mail address.)

You may also be interested in :